PDB entry 4u05

View 4u05 on RCSB PDB site
Description: Homodimeric Single Domain Antibody (sdAb) against Staphylococcal enterotoxin B (SEB) S74A Variant
Class: immune system
Keywords: camelid, single domain antibody, dimer, amyloid-like, immune system
Deposited on 2014-07-11, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single Domain Antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U05 (Start-132)
    Domains in SCOPe 2.07: d4u05a_
  • Chain 'B':
    Compound: Single Domain Antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U05 (Start-132)
    Domains in SCOPe 2.07: d4u05b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u05A (A:)
    gshmevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsiaadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u05A (A:)
    mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsiaadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
    gqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u05B (B:)
    gshmevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsiaadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u05B (B:)
    mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsiaadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
    gqgtqvtvss