PDB entry 4tyx

View 4tyx on RCSB PDB site
Description: Structure of aquoferric sperm whale myoglobin L29H/F33Y/F43H/S92A mutant
Class: oxygen transport,oxidoreductase
Keywords: Globin, Oxidoreductase, Artificial, Engineered
Deposited on 2014-07-09, released 2014-08-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.16
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
      • engineered mutation (32)
      • engineered mutation (42)
      • engineered mutation (91)
    Domains in SCOPe 2.05: d4tyxa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tyxA (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlykshpetlekhdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqahatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg