PDB entry 4tyu

View 4tyu on RCSB PDB site
Description: Homodimeric Single Domain Antibody (sdAb) against Staphylococcal enterotoxin B (SEB)
Class: immune system
Keywords: Single domain antibody, camelid, v-set domain, amyloid like, IMMUNE SYSTEM
Deposited on 2014-07-09, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single Domain Antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TYU (Start-132)
    Domains in SCOPe 2.07: d4tyua_
  • Chain 'B':
    Compound: Single Domain Antibody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TYU (Start-132)
    Domains in SCOPe 2.07: d4tyub_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tyuA (A:)
    gshmevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tyuA (A:)
    mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
    gqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tyuB (B:)
    gshmevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tyuB (B:)
    mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
    gqgtqvtvss