PDB entry 4tyh

View 4tyh on RCSB PDB site
Description: Ternary complex of P38 and MK2 with a P38 inhibitor
Class: Transferase/Transferase inhibitor
Keywords: P38, MK2, P38 inhibitor, Transferase-Transferase inhibitor complex
Deposited on 2014-07-08, released 2015-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tyha_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tyhb_
  • Heterogens: 39G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tyhA (A:)
    glqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwr
    asqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyv
    apevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpe
    wsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwe
    dvkeemtsalatmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tyhA (A:)
    glqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwr
    asqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksi
    geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyv
    apevlgpekydkscdmwslgvimyillcgyppfysnhgrmgqyefpnpewsevseevkml
    irnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsala
    tmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tyhB (B:)
    ptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltdd
    hvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyvat
    rwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgae
    llkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalah
    ayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tyhB (B:)
    ptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltdd
    hvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglagyvatrwyrapei
    mynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarny
    iqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddep
    vadpydqsfesrdllidewksltydevisfvpppl