PDB entry 4tyg

View 4tyg on RCSB PDB site
Description: Structural analysis of the human Fibroblast Growth Factor Receptor 4 Kinase
Class: transferase
Keywords: Fibroblast growth factor receptor, Kinase, Transferase, Dovitinib, Ponatinb, Proteros Biostructures GmbH
Deposited on 2014-07-08, released 2014-09-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR4, JTK2, TKF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22455 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.04: d4tyga_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tygA (A:)
    amgsaglvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdparpdqastvav
    kmlkdnasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlrefl
    rarrppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcihrdlaarnvlvte
    dnvmkiadfglargvhhidyykktsngrlpvkwmapealfdrvythqsdvwsfgillwei
    ftlggspypgipveelfsllreghrmdrpphcppelyglmrecwhaapsqrptfkqlvea
    ldkvllavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tygA (A:)
    mgsaglvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdparpdqastvavk
    mlkdnasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflr
    arrpplsfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfglargvh
    hidyykktsngrlpvkwmapealfdrvythqsdvwsfgillweiftlggspypgipveel
    fsllreghrmdrpphcppelyglmrecwhaapsqrptfkqlvealdkvllavs