PDB entry 4tye

View 4tye on RCSB PDB site
Description: Structural analysis of the human Fibroblast Growth Factor Receptor 4 Kinase
Class: transferase
Keywords: Fibroblast growth factor receptor, Kinase, Transferase, Dovitinib, Ponatinb, Proteros Biostructures GmbH
Deposited on 2014-07-08, released 2014-09-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR4, JTK2, TKF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4tyea_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tyeA (A:)
    amgsaglvsldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdparpdqastvav
    kmlkdnasdkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlrefl
    rarrppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcihrdlaarnvlvte
    dnvmkiadfglargvhhidyykktsngrlpvkwmapealfdrvythqsdvwsfgillwei
    ftlggspypgipveelfsllreghrmdrpphcppelyglmrecwhaapsqrptfkqlvea
    ldkvllavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tyeA (A:)
    sldlpldplwefprdrlvlgkplgegcfgqvvraeafgmdparpdqastvavkmlkdnas
    dkdladlvsemevmkligrhkniinllgvctqegplyvivecaakgnlreflrarrppgp
    dlspdgegplsfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfgla
    rgvhhidyylpvkwmapealfdrvythqsdvwsfgillweiftlggspypgipveelfsl
    lreghrmdrpphcppelyglmrecwhaapsqrptfkqlvealdkvllavsee