PDB entry 4tx3

View 4tx3 on RCSB PDB site
Description: Complex of the X-domain and OxyB from Teicoplanin Biosynthesis
Class: oxidoreductase
Keywords: non-ribosomal peptide synthetase, condensation-type domain, teicoplanin biosynthesis, oxygenase complex, oxidoreductase, hydrolase
Deposited on 2014-07-02, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OxyB protein
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: tcp20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tx3a_
  • Chain 'B':
    Compound: Peptide synthetase, module 7
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: teiD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZZJ3 (4-End)
      • expression tag (0-3)
  • Heterogens: HEM, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tx3A (A:)
    gidpftmsgdgsppihtrrqgfdpadelraagtltkisigsgadaettwlaaghavvrqv
    lgdhkrfstrrrfdrrdeiggtgvfrprelvgnlmdydppehtrlrhlltpgftqrrmrr
    laprieeivtdrldameqagppadlielfadevpgavlceligvprddqamflqlchrhl
    daslsarkraaageafarylvammarerkdpgdgfigsivaehgdtitdeelrgvcvqlm
    lagddnvsgmiglgvlallrhpeqiaalrgddqsadravdeliryltvpyaptprtaved
    vmvadqvikegetvlcslpmanrdrallpdadrldvtrtpvphvafghgihhclgaaltr
    lqlriaytalwrrfpalqladpaqeimfrtstpaygltsllvaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tx3A (A:)
    sppihtrrqgfdpadelraagtltkisttwlaaghavvrqvlgdhkrfstrrvfrprelv
    gnlmdydppehtrlrhlltpgftqrrmrrlaprieeivtdrldameqagppadlielfad
    evpgavlceligvprddqamflqlchrhldaslsarkraaageafarylvammarerkdp
    gdgfigsivaehgdtitdeelrgvcvqlmlagddnvsgmiglgvlallrhpeqiaalrgd
    dqsadravdeliryltvpyaptprtavedvmvadqvikegetvlcslpmanrdrallpda
    drldvtrtpvphvafghgihhclgaaltrlqlriaytalwrrfpalqladpaqeimfrts
    tpaygltsllvaw
    

  • Chain 'B':
    No sequence available.