PDB entry 4twz

View 4twz on RCSB PDB site
Description: Crystal Structure Analysis of E Coli. RecA Protein
Class: recombination
Keywords: homologous recombination, DNA binding, recombination
Deposited on 2014-07-02, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein recA
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: recA, lexB, recH, rnmB, tif, umuB, zab, b2699, JW2669
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4twza1, d4twza2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4twzA (A:)
    aidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgr
    iveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpd
    tgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklag
    nlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgs
    etrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykgekigq
    gkanatawlkdnpetakeiekkvrelllsnpnstpdfsvddsegvaetnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4twzA (A:)
    kqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiy
    gpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqa
    leicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnlkqs
    ntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgsetrvk
    vvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykgekigqgkana
    tawlkdnpetakeiekkvrelllsnpn