PDB entry 4twv

View 4twv on RCSB PDB site
Description: Horse heart myoglobin mutant (K45E/K63E/K96E) with Zn-deuteroporphyrin IX
Class: oxygen transport
Keywords: Myoglobin, Zn-deuteroporphyrin IX, Oxygen transport
Deposited on 2014-07-02, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (Start-153)
      • engineered mutation (45)
      • engineered mutation (63)
      • engineered mutation (96)
    Domains in SCOPe 2.07: d4twva_
  • Heterogens: ZND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4twvA (A:)
    mglsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkase
    dlkehgtvvltalggilkkkghheaelkplaqshatehkipikylefisdaiihvlhskh
    pgdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4twvA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
    lkehgtvvltalggilkkkghheaelkplaqshatehkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg