PDB entry 4twu

View 4twu on RCSB PDB site
Description: Horse heart myoglobin mutant (D44K/D60K/E85K) with Zn-deuteroporphyrin IX
Class: oxygen transport
Keywords: Myoglobin, Zn-deuteroporphyrin IX, Oxygen transport
Deposited on 2014-07-02, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (Start-153)
      • engineered mutation (44)
      • engineered mutation (60)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d4twua_
  • Heterogens: ZND, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4twuA (A:)
    mglsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkase
    klkkhgtvvltalggilkkkghheaklkplaqshatkhkipikylefisdaiihvlhskh
    pgdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4twuA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkasek
    lkkhgtvvltalggilkkkghheaklkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg