PDB entry 4twm

View 4twm on RCSB PDB site
Description: Crystal structure of dioscorin from Dioscorea japonica
Class: plant protein
Keywords: storage protein, carbonic anhydrase activity, dehydroascorbate reductase activity, PLANT PROTEIN
Deposited on 2014-07-01, released 2015-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dioscorin 5
    Species: Dioscorea japonica [TaxId:4673]
    Gene: dio5
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7MAQ2
      • engineered mutation (8)
    Domains in SCOPe 2.06: d4twma_
  • Chain 'B':
    Compound: Dioscorin 5
    Species: Dioscorea japonica [TaxId:4673]
    Gene: dio5
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7MAQ2
      • engineered mutation (8)
    Domains in SCOPe 2.06: d4twmb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4twmA (A:)
    vedefsyidgnpngpenwgnlkpewetcgkgmeqspiqlrdnrvifdqtlgklrrnyrav
    darlrnsghdvlvdfkgnagslsinrveyqlkrihfhspsehemngerfdleaqlvhesq
    dqkravvsilfrfgradpflsdledfikqfsnsqkneinagvvdpnqlqiddsayyrymg
    sftappctegiswtvmrkvatvsprqvlllkqavnenainnarplqptnfrsvfyfeqlk
    sklgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4twmA (A:)
    defsyidgnpngpenwgnlkpewetcgkgmeqspiqlrdnrvifdqtlgklrrnyravda
    rlrnsghdvlvdfkgnagslsinrveyqlkrihfhspsehemngerfdleaqlvhesqdq
    kravvsilfrfgradpflsdledfikqfsnsqkneinagvvdpnqlqiddsayyrymgsf
    tappctegiswtvmrkvatvsprqvlllkqavnenainnarplqptnfrsvfyfeqlks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4twmB (B:)
    vedefsyidgnpngpenwgnlkpewetcgkgmeqspiqlrdnrvifdqtlgklrrnyrav
    darlrnsghdvlvdfkgnagslsinrveyqlkrihfhspsehemngerfdleaqlvhesq
    dqkravvsilfrfgradpflsdledfikqfsnsqkneinagvvdpnqlqiddsayyrymg
    sftappctegiswtvmrkvatvsprqvlllkqavnenainnarplqptnfrsvfyfeqlk
    sklgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4twmB (B:)
    efsyidgnpngpenwgnlkpewetcgkgmeqspiqlrdnrvifdqtlgklrrnyravdar
    lrnsghdvlvdfkgnagslsinrveyqlkrihfhspsehemngerfdleaqlvhesqdqk
    ravvsilfrfgradpflsdledfikqfsnsqkneinagvvdpnqlqiddsayyrymgsft
    appctegiswtvmrkvatvsprqvlllkqavnenainnarplqptnfrsvfyfeql