PDB entry 4twc

View 4twc on RCSB PDB site
Description: 2-Benzamido-N-(1H-benzo[d]imidazol-2-yl)thiazole-4- carboxamide derivatives as potent inhibitors of CK1d/e
Class: transferase
Keywords: CK1d, CK1e, Phosphorylation, Small molecule inhibitor, transferase
Deposited on 2014-06-30, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48730 (Start-294)
      • engineered mutation (12)
    Domains in SCOPe 2.04: d4twca_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48730 (0-294)
      • engineered mutation (12)
  • Heterogens: SO4, GOL, BOG, 37J, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4twcA (A:)
    melrvgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4twcA (A:)
    elrvgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqg
    gvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihs
    knfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryas
    inthlgieqsrrddleslgyvlmyfnlgslpwqglkatkrqkyerisekkmstpievlck
    gypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf
    

  • Chain 'B':
    No sequence available.