PDB entry 4tvy

View 4tvy on RCSB PDB site
Description: Apo resorufin ligase
Class: transferase
Keywords: E. coli LplA, computational enzyme design, TRANSFERASE
Deposited on 2014-06-28, released 2014-10-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:83333]
    Gene: lplA, yjjF, b4386, JW4349
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32099 (Start-340)
      • engineered mutation (23)
      • engineered mutation (150)
      • engineered mutation (152)
    Domains in SCOPe 2.06: d4tvya1, d4tvya2
  • Chain 'B':
    Compound: Lipoate-protein ligase A
    Species: Escherichia coli [TaxId:83333]
    Gene: lplA, yjjF, b4386, JW4349
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32099 (Start-340)
      • engineered mutation (23)
      • engineered mutation (150)
      • engineered mutation (152)
    Domains in SCOPe 2.06: d4tvyb1, d4tvyb2
  • Heterogens: 37R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tvyA (A:)
    gshmstlrllisdsydpwfnlavaecifrqmpatqrvlflwrnadtvvigraqnpwkecn
    trrmeednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsae
    asgrndlvvktvegdrkvsgsayretkdrgahggtlllnadlsrlanylnpdkkklaakg
    itsvrsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfa
    rqsswewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagr
    lqgclyradmlqqeceallvdfpeqekelrelsawmagavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvyA (A:)
    stlrllisdsydpwfnlavaecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgahggtlllnadlsrlanylnpdkkklaarvtnlt
    ellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfgqa
    pafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradmlq
    qeceallvdfpeqekelrelsawmagavr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tvyB (B:)
    gshmstlrllisdsydpwfnlavaecifrqmpatqrvlflwrnadtvvigraqnpwkecn
    trrmeednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsae
    asgrndlvvktvegdrkvsgsayretkdrgahggtlllnadlsrlanylnpdkkklaakg
    itsvrsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfa
    rqsswewnfgqapafshllderftwggvelhfdvekghitraqvftdslnpaplealagr
    lqgclyradmlqqeceallvdfpeqekelrelsawmagavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvyB (B:)
    stlrllisdsydpwfnlavaecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
    eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
    ndlvvktvegdrkvsgsayretkdrgahggtlllnadlsrlanylnrvtnltellpgith
    eqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfgqapafshlld
    erftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradmlqqeceallv
    dfpeqekelrelsawmagavr