PDB entry 4tvf

View 4tvf on RCSB PDB site
Description: OxyB from Actinoplanes teichomyceticus
Class: oxidoreductase
Keywords: Cytochrome P450 phenolic coupling enzyme teicoplanin biosynthesis, oxidoreductase
Deposited on 2014-06-26, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: OxyB
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: tcp20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tvfa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tvfA (A:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftmsgdgsppihtrrqgfdpadelraagt
    ltkisigsgadaettwlaaghavvrqvlgdhkrfstrrrfdrrdeiggtgvfrprelvgn
    lmdydppehtrlrhlltpgftqrrmrrlaprieeivtdrldameqagppadlielfadev
    pgavlceligvprddqamflqlchrhldaslsarkraaageafarylvammarerkdpgd
    gfigsivaehgdtitdeelrgvcvqlmlagddnvsgmiglgvlallrhpeqiaalrgddq
    sadravdeliryltvpyaptprtavedvmvadqvikegetvlcslpmanrdrallpdadr
    ldvtrtpvphvafghgihhclgaaltrlqlriaytalwrrfpalqladpaqeimfrtstp
    aygltsllvaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvfA (A:)
    sppihtrrqgfdpadelraagtltkistwlaaghavvrqvlgdhkrfstrrelvgnlmdy
    dppehtrlrhlltpgftqrrmrrlaprieeivtdrldameqagppadlielfadevpgav
    lceligvprddqamflqlchrhafarylvammarerkdpgdgfigsivaehgdtitdeel
    rgvcvqlmlagddnvsgmiglgvlallrhpeqiaalrgddqsadravdeliryltvpyap
    tprtavedvmvadqvikegetvlcslpmanrdrallpdadrldvtrtpvphvafghgihh
    clgaaltrlqlriaytalwrrfpalqladpaqeimfrtstpaygltsllvaw