PDB entry 4tva

View 4tva on RCSB PDB site
Description: Universal Pathway for Post-Transfer Editing Reactions: Insight from Crystal structure of TthPheRS with Puromycine
Class: ligase/antibiotic
Keywords: puromycine, editing, tRNA, PheRS, LIGASE-ANTIBIOTIC complex
Deposited on 2014-06-26, released 2015-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylalanine--tRNA ligase alpha subunit
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tvaa_
  • Chain 'B':
    Compound: Phenylalanine--tRNA ligase beta subunit
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tvab1, d4tvab2, d4tvab3, d4tvab4, d4tvab5, d4tvab6
  • Heterogens: PHE, PUY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tvaA (A:)
    mleealaaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaa
    leaalearekaleeaalkealerervdvslpgaslfsgglhpitlmerelveifralgyq
    avegpeveseffnfdalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthts
    pmqvrymvahtppfrivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyel
    aqalfgpdskvrfqpvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrer
    lglppayrgvtgfafglgverlamlrygipdiryffggrlkfleqfkgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvaA (A:)
    rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
    ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
    feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
    aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
    lrygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tvaB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp