PDB entry 4tu5

View 4tu5 on RCSB PDB site
Description: Staphylococcus aureus Dihydrofolate Reductase complexed with NADPH and 6-ETHYL-5-[(3S)-3-[3-METHOXY-5-(PYRIDIN-4-YL)PHENYL]BUT-1-YN-1-YL]PYRIMIDINE-2,4-DIAMINE (UCP1062)
Class: OXIDOREDUCTASE/OXIDOREDUCTASE Inhibitor
Keywords: Dihydrofolate reductase, Oxidoreductase, Methicillin-resistant Staphylococcus aureus, Antifolates, Enantiopure Inhibitors, OXIDOREDUCTASE-OXIDOREDUCTASE Inhibitor complex
Deposited on 2014-06-23, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:273036]
    Gene: dfrB, SAB1281c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tu5x_
  • Heterogens: NDP, 06W, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tu5X (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk