PDB entry 4tu4

View 4tu4 on RCSB PDB site
Description: Crystal structure of ATAD2A bromodomain complexed with 3-(3,5-dimethyl-1,2-oxazol-4-yl)-5-[(phenylsulfonyl)amino]benzoicacid
Class: gene regulation
Keywords: ATAD2A - bromodomain- inhibitor complex, GENE REGULATION
Deposited on 2014-06-23, released 2014-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATPase family AAA domain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: ATAD2, L16, PRO2000
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PL18 (2-129)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d4tu4a1, d4tu4a2
• Heterogens: SO4, GOL, 37N, CL, DMS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4tu4A (A:)
  smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
  dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
  qlceeiqesr