PDB entry 4tt6

View 4tt6 on RCSB PDB site
Description: Crystal structure of ATAD2A bromodomain double mutant N1063A-Y1064A in apo form
Class: gene regulation
Keywords: acetyllysine reader deficient bromodomain, GENE REGULATION
Deposited on 2014-06-19, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase family AAA domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ATAD2, L16, PRO2000
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PL18 (2-129)
      • expression tag (0-1)
      • engineered mutation (84-85)
    Domains in SCOPe 2.07: d4tt6a1, d4tt6a2
  • Heterogens: SO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4tt6A (A:)
smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
dlhkyltvkdylrdidlicsnaleaapdrdpgdrlirhracalrdtayaiikeeldedfe
qlceeiqesr