PDB entry 4tsw

View 4tsw on RCSB PDB site
Description: high resolution crystal structure of a human tnf-alpha mutant
Class: lymphokine
Keywords: lymphokine, low systemic toxicity, mutant
Deposited on 1997-10-29, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 1999-05-07, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor-alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (1-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.07: d4tswa_
  • Chain 'B':
    Compound: tumor necrosis factor-alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (1-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.07: d4tswb_
  • Chain 'C':
    Compound: tumor necrosis factor-alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (1-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.07: d4tswc_
  • Chain 'D':
    Compound: tumor necrosis factor-alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (1-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.07: d4tswd_
  • Chain 'E':
    Compound: tumor necrosis factor-alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (1-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.07: d4tswe_
  • Chain 'F':
    Compound: tumor necrosis factor-alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (1-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.07: d4tswf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tswA (A:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tswA (A:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tswB (B:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tswB (B:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4tswC (C:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tswC (C:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4tswD (D:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tswD (D:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4tswE (E:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tswE (E:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4tswF (F:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tswF (F:)
    sdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqg
    cpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlek
    gdrlsaeinrpdyldfaesgqvyfgiial