PDB entry 4tsv

View 4tsv on RCSB PDB site
Description: high resolution crystal structure of a human tnf-alpha mutant
Class: lymphokine
Keywords: lymphokine, tnf
Deposited on 1997-10-29, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-149)
      • engineered (21)
      • engineered (44)
      • engineered (48)
    Domains in SCOPe 2.07: d4tsva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tsvA (A:)
    psdkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgq
    gcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqle
    kgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tsvA (A:)
    dkpvahvvanpqaegqlqwsnrranallangvelrdnqlvvpieglfliysqvlfkgqgc
    psthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlekg
    drlsaeinrpdyldfaesgqvyfgiial