PDB entry 4tsu

View 4tsu on RCSB PDB site
Description: crystal structure of ketosteroid isomerase complexed with inhibitor
Class: isomerase
Keywords: isomerase, inhibitor, complex, crystal,
Deposited on 1997-10-29, released 1998-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 1999-02-16, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketosteroid Isomerase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ketosteroid Isomerase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tsub_
  • Heterogens: EQU, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4tsuB (B:)
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsvrepq

    Sequence, based on observed residues (ATOM records): (download) 
    >4tsuB (B:)
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv