PDB entry 4ts6

View 4ts6 on RCSB PDB site
Description: Crystal structure of the RIM C2A domain from Drosophila.
Class: transport protein
Keywords: C2A domain, transport protein
Deposited on 2014-06-18, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab3 interacting molecule variant 2
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Rim
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ts6a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ts6A (A:)
    gplgsipiegrlqlklgydqntlqlivtlvcatglslrqsgagrnpyakvfllpdrshks
    krrtktvgttceprwgqtfvysglrrcdlngrllevtlwdyvrygandfigevvidlahh
    ilddeaewyqlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ts6A (A:)
    piegrlqlklgydqntlqlivtlvcatglslrqsgagrnpyakvfllpdrshkskrrtkt
    vgttceprwgqtfvysglrrcdlngrllevtlwdyvrygandfigevvidlahhilddea
    ewyqlq