PDB entry 4trx

View 4trx on RCSB PDB site
Description: high-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution
Class: electron transport
Keywords: electron transport
Deposited on 1990-12-17, released 1992-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10599 (1-104)
    • conflict (73)
  Domains in SCOPe 2.08: d4trxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4trxA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
  dcqdvasecevkctptfqffkkgqkvgefsgankekleatinelv