PDB entry 4trr

View 4trr on RCSB PDB site
Description: Crystal structure of a putative Putative D-beta-hydroxybutyrate dehydrogenase from Burkholderia cenocepacia J2315
Class: oxidoreductase
Keywords: SSGCID, Burkholderia cenocepacia, D-beta-hydroxybutyrate dehydrogenase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, Oxidoreductase
Deposited on 2014-06-17, released 2014-08-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trra_
  • Chain 'B':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trrb_
  • Chain 'C':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trrc_
  • Chain 'D':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trrd_
  • Chain 'E':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trre_
  • Chain 'F':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trrf_
  • Chain 'G':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trrg_
  • Chain 'H':
    Compound: Putative D-beta-hydroxybutyrate dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: BCAM0022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4trrh_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4trrA (A:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrA (A:)
    msnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigv
    amdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgafl
    ttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvr
    shvvcpgfvrtplvdkqipeqiseeevikkvmlgntvdgvfttvqdvaqtvlflsafpsa
    altgqsfivshgwfmq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4trrB (B:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrB (B:)
    snlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigva
    mdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgaflt
    tkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrs
    hvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdvaqtvlflsa
    fpsaaltgqsfivshgwfmq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4trrC (C:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrC (C:)
    msnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigv
    amdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgafl
    ttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvr
    shvvcpgfvrtplvdkqipeqiseeevikkvmlgntvdgvfttvqdvaqtvlflsafpsa
    altgqsfivshgwfmq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4trrD (D:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrD (D:)
    nlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigvam
    dvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgafltt
    kaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrsh
    vvcpgfvrtplvdkqipeqakeseeevikkvmlgntvdgvfttvqdvaqtvlflsafpsa
    altgqsfivshgwfmq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4trrE (E:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrE (E:)
    nlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigvam
    dvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgafltt
    kaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrsh
    vvcpgfvrseeevikkvmlgntvdgvfttvqdvaqtvlflsafpsaaltgqsfivshgwf
    mq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4trrF (F:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrF (F:)
    snlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigva
    mdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgaflt
    tkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrs
    hvvcpgfvrtplvdkqipeiseeevikkvmlgntvdgvfttvqdvaqtvlflsafpsaal
    tgqsfivshgwfmq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4trrG (G:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrG (G:)
    ngktavvtgaasgigkeialelakagaavaiadlnqdganavakaigvamdvtneeavnt
    gidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgaflttkaalkhmykd
    drggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrshvvcpgfvrtp
    lmlgntvdgvfttvqdvaqtvlflsafpsaaltgqsfivshgwfmq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4trrH (H:)
    mahhhhhhmsnlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeink
    aggkaigvamdvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqa
    ihvdgaflttkaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlak
    egakhnvrshvvcpgfvrtplvdkqipeqakelgiseeevikkvmlgntvdgvfttvqdv
    aqtvlflsafpsaaltgqsfivshgwfmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trrH (H:)
    nlngktavvtgaasgigkeialelakagaavaiadlnqdganavadeinkaggkaigvam
    dvtneeavntgidkvaeafgsvdilvsnagiqivnpienysfadwkkmqaihvdgafltt
    kaalkhmykddrggvviymgsvhsheasplksayvtakhgllglarvlakegakhnvrsh
    vvcpgfvrtplvdkqipeqakiseeevikkvmlgntvdgvfttvqdvaqtvlflsafpsa
    altgqsfivshgwfmq