PDB entry 4trm

View 4trm on RCSB PDB site
Description: Structure of the apo form of InhA from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: ENOYL REDUCTASE, Oxidoreductase
Deposited on 2014-06-17, released 2015-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4trma_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4trmb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4trmc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4trmd_
  • Chain 'E':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4trme_
  • Chain 'F':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4trmf_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4trmA (A:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trmA (A:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirlgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpat
    tgdiiyadggahtqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4trmB (B:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trmB (B:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirggalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwl
    pattgdiiyadggahtqll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4trmC (C:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trmC (C:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfrlrliqritdrlpakapllel
    dvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihis
    aysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkyg
    vrsnlvaagpiralgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpat
    tgdiiyadggahtqll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4trmD (D:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trmD (D:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgrlrliqritdrlpakaplleld
    vqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisa
    ysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygv
    rsnlvaagpirgaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiya
    dggahtqll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4trmE (E:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trmE (E:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlliqritdrlpakapllel
    dvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihis
    aysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkyg
    vrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktvc
    allsdwlpattgdiiyadggahtqll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4trmF (F:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4trmF (F:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfrlrliqritdrlpakapllel
    dvqneehlaslagrvteaikldgvvhsigfmpqtgmginpffdapyadvskgihisaysy
    asmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygvrsn
    lvaagpirlgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdii
    yadggahtqll