PDB entry 4tpr

View 4tpr on RCSB PDB site
Description: Structure of Tau5 antibody Fab fragment
Class: immune system
Keywords: Immune system, monoclonal antibody
Deposited on 2014-06-09, released 2015-07-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TPR (0-220)
  • Chain 'L':
    Compound: If kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NHM3 (0-217)
      • conflict (31)
      • conflict (100)
    Domains in SCOPe 2.05: d4tprl1, d4tprl2
  • Heterogens: PG4, CL, PGE, NA, PEG, TRS, 33O, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tprL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne