PDB entry 4tpm

View 4tpm on RCSB PDB site
Description: Crystal structure of 2-(3-alkoxy-1-azetidinyl) quinolines as PDE10A Inhibitors
Class: Hydrolase/Hydrolase Inhibitor
Keywords: PDE10A, quinolines, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2014-06-08, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tpma_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tpmb_
  • Heterogens: SO4, GOL, 35E, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tpmA (A:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tpmA (A:)
    lpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrvp
    yhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpla
    alyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnrk
    qleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegdem
    kklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqwe
    kvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tpmB (B:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tpmB (B:)
    tlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrv
    pyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpl
    aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
    kqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
    mkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqw
    ekvirge