PDB entry 4tpi

View 4tpi on RCSB PDB site
Description: the refined 2.2-angstroms (0.22-nm) x-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the arg15 analogue of bovine pancreatic trypsin inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: complex (proteinase/inhibitor), hydrolase/hydrolase inhibitor complex
Deposited on 1985-06-11, released 1985-11-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: bovine pancreatic trypsin inhibitor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • conflict (14)
    Domains in SCOPe 2.05: d4tpii_
  • Chain 'Z':
    Compound: trypsinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4tpiz_
  • Heterogens: VAL, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tpiI (I:)
    rpdfcleppytgpcrariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4tpiZ (Z:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tpiZ (Z:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn