PDB entry 4tph

View 4tph on RCSB PDB site
Description: Selectivity mechanism of a bacterial homologue of the human drug peptide transporters PepT1 and PepT2
Class: membrane protein
Keywords: Membrane protein, secondary active transporter, complex
Deposited on 2014-06-07, released 2014-07-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proton:oligopeptide symporter POT family
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4tpha_
  • Chain 'B':
    Compound: Proton:oligopeptide symporter POT family
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4tphb_
  • Heterogens: ZN, LMT, ALA, DBY

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tphA (A:)
    mtlgtnqvskthsfmtvslielwerfgyygmqalivyfmvqrlgfddsranlvwsacaal
    iyvspaiggwvgdkilgtkrtmllgagilsvgyalmtvptentwfmfsalgvivvgnglf
    kpnagnlvrkiyegddskidsaftiyymavnvgstfsmlltpwikdyvnaqygnefgwha
    afavccvgilvglgnyalmhkslanygsepdtrpvnkkslaivlalaalsvvasaiiley
    edvarvfvyaagvavlgiffhlirtsepseragliaaliltvqtvfffifyqqmstslal
    falrnvdwdfqvfgthlwtwspaqfqalnpiwimvlspvlawsyswagrnnkdfsiaakf
    algfavvaigffiygfagqfavngktsswvmiwgyasyslgellvsglglamiaryvpar
    mggfmmgayfvasgisqylggvvanfasvpqdlvdplqtlpvytnlfnklgvaavvctii
    alavlplmrrlteshhahssiennaaaslrdvkaeqaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tphA (A:)
    vskthsfmtvslielwerfgyygmqalivyfmvqrlgfddsranlvwsacaaliyvspai
    ggwvgdkilgtkrtmllgagilsvgyalmtvptentwfmfsalgvivvgnglfkpnagnl
    vrkiyeskidsaftiyymavnvgstfsmlltpwikdyvnaqygnefgwhaafavccvgil
    vglgnyalmhkslanygsepdtrpvnkkslaivlalaalsvvasaiileyedvarvfvya
    agvavlgiffhleragliaaliltvqtvfffifyqqmstslalfalrnvdwdfqvfgthl
    wtwspaqfqalnpiwimvlspvlawiaakfalgfavvaigffiygfagqfavngktsswv
    miwgyasyslgellvsglglamiarmmgayfvasgisqylggvvanfasvpqdlvdplqt
    lpvytnlfnklgvaavvctiialavlplmrrlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tphB (B:)
    mtlgtnqvskthsfmtvslielwerfgyygmqalivyfmvqrlgfddsranlvwsacaal
    iyvspaiggwvgdkilgtkrtmllgagilsvgyalmtvptentwfmfsalgvivvgnglf
    kpnagnlvrkiyegddskidsaftiyymavnvgstfsmlltpwikdyvnaqygnefgwha
    afavccvgilvglgnyalmhkslanygsepdtrpvnkkslaivlalaalsvvasaiiley
    edvarvfvyaagvavlgiffhlirtsepseragliaaliltvqtvfffifyqqmstslal
    falrnvdwdfqvfgthlwtwspaqfqalnpiwimvlspvlawsyswagrnnkdfsiaakf
    algfavvaigffiygfagqfavngktsswvmiwgyasyslgellvsglglamiaryvpar
    mggfmmgayfvasgisqylggvvanfasvpqdlvdplqtlpvytnlfnklgvaavvctii
    alavlplmrrlteshhahssiennaaaslrdvkaeqaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tphB (B:)
    vskthsfmtvslielwerfgyygmqalivyfmvqrlgfddsranlvwsacaaliyvspai
    ggwvgdkilgtkrtmllgagilsvgyalmtvptentwfmfsalgvivvgnglfkpnagnl
    vrkiyeskidsaftiyymavnvgstfsmlltpwikdyvnaqygnefgwhaafavccvgil
    vglgnyalmhkslanygsepdtrpvnkkslaivlalaalsvvasaiileyedvarvfvya
    agvavlgiffhleragliaaliltvqtvfffifyqqmstslalfalrnvdwdfqvfgthl
    wtwspaqfqalnpiwimvlspvlawiaakfalgfavvaigffiygfagqfavngktsswv
    miwgyasyslgellvsglglamiarmmgayfvasgisqylggvvanfasvpqdlvdplqt
    lpvytnlfnklgvaavvctiialavlplmrrlt