PDB entry 4toq

View 4toq on RCSB PDB site
Description: Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity
Class: hydrolase
Keywords: chitinase, metal binding, a, b-barrel, pomegranate seed, HYDROLASE
Deposited on 2014-06-06, released 2014-09-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.157
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class III chitinase
    Species: Punica granatum [TaxId:22663]
    Gene: PSC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4toqa_
  • Chain 'B':
    Compound: Class III chitinase
    Species: Punica granatum [TaxId:22663]
    Gene: PSC
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Class III chitinase
    Species: Punica granatum [TaxId:22663]
    Gene: PSC
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Class III chitinase
    Species: Punica granatum [TaxId:22663]
    Gene: PSC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4toqA (A:)
    gdiaiywgqnggegtlastcdtgryayvivsfvttfgnfrapvvnlaghcdpaagtctgl
    sdeirscqgkdikvlmsigggagdyslvseadadnfadylwnnflggqsssrplgdavld
    gidfdielgtttfydtlaralssrstqaakvyltaapqcphpdshldaalntglfdnvwi
    qfynnplaqcqyssgntndilsswntwtssttagkiflglpaapeaagsgyippdvltgq
    ilpqiktsakyggvmlyskfydttysttikdqv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.