PDB entry 4tob

View 4tob on RCSB PDB site
Description: 1.95A resolution structure of BfrB (Q151L) from Pseudomonas aeruginosa
Class: oxidoreductase
Keywords: ELECTRON TRANSPORT, IRON STORAGE, iron binding, iron mobilization, OXIDOREDUCTASE
Deposited on 2014-06-05, released 2015-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4toba_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobb_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobc_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobd_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobe_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobf_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobg_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobh_
  • Chain 'I':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobi_
  • Chain 'J':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobj_
  • Chain 'K':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobk_
  • Chain 'L':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobl_
  • Chain 'M':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobm_
  • Chain 'N':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79 (0-End)
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobn_
  • Chain 'O':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobo_
  • Chain 'P':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobp_
  • Chain 'Q':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobq_
  • Chain 'R':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobr_
  • Chain 'S':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobs_
  • Chain 'T':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobt_
  • Chain 'U':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobu_
  • Chain 'V':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobv_
  • Chain 'W':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobw_
  • Chain 'X':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: bfrB, PA3531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HY79
      • engineered mutation (150)
    Domains in SCOPe 2.06: d4tobx_
  • Heterogens: MES, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tobA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobA (A:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tobB (B:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobB (B:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4tobC (C:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobC (C:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4tobD (D:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobD (D:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4tobE (E:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobE (E:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4tobF (F:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobF (F:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhed
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4tobG (G:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobG (G:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4tobH (H:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobH (H:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4tobI (I:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobI (I:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4tobJ (J:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobJ (J:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4tobK (K:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobK (K:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4tobL (L:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobL (L:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4tobM (M:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobM (M:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4tobN (N:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobN (N:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4tobO (O:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobO (O:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4tobP (P:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobP (P:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4tobQ (Q:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobQ (Q:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4tobR (R:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobR (R:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4tobS (S:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobS (S:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4tobT (T:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobT (T:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4tobU (U:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobU (U:)
    gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
    lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
    ileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4tobV (V:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobV (V:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4tobW (W:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobW (W:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhed
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4tobX (X:)
    mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
    rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
    kdileseeehidyletqlgliqkvglenyllshmhedd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tobX (X:)
    kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
    ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
    dileseeehidyletqlgliqkvglenyllshmhe