PDB entry 4tnn

View 4tnn on RCSB PDB site
Description: Crystal structure of Escherichia coli protein YodA in complex with Ni - artifact of purification.
Class: metal binding protein
Keywords: YodA, purification artifact, metal-binding lipocalin, METAL BINDING PROTEIN
Deposited on 2014-06-04, released 2014-06-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metal-binding lipocalin
    Species: ESCHERICHIA COLI STR. K-12 SUBSTR. MC4100 [TaxId:1403831]
    Gene: yodA, BN896_1774
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4tnna_
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4tnnA (A:)
hghhshgkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkad
adktktfaeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkk
gvrylfeckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyq
lsseevveemmsh