PDB entry 4tnf

View 4tnf on RCSB PDB site
Description: Crystal Structure of Human Transthyretin Lys15Trp Mutant
Class: transport protein
Keywords: human transthyretin, amyloid, transthyretin, mutant, TRANSPORT PROTEIN
Deposited on 2014-06-04, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-End)
      • engineered mutation (6)
    Domains in SCOPe 2.07: d4tnfa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (6)
    Domains in SCOPe 2.07: d4tnfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tnfA (A:)
    kcplmvwvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpkeh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tnfA (A:)
    kcplmvwvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tnfB (B:)
    kcplmvwvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpkeh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tnfB (B:)
    cplmvwvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn