PDB entry 4tne

View 4tne on RCSB PDB site
Description: Crystal Structure of Human Transthyretin Thr119Tyr Mutant
Class: transport protein
Keywords: human transthyretin, amyloid, transthyretin, mutant, TRANSPORT PROTEIN
Deposited on 2014-06-04, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (110)
    Domains in SCOPe 2.07: d4tnea_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (110)
    Domains in SCOPe 2.07: d4tneb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tneA (A:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysystyavvtnpkeh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tneA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystyavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tneB (B:)
    kcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysystyavvtnpkeh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tneB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystyavvtn