PDB entry 4tnc

View 4tnc on RCSB PDB site
Description: refined structure of chicken skeletal muscle troponin c in the two-calcium state at 2-angstroms resolution
Class: contractile system protein
Keywords: contractile system protein
Deposited on 1987-09-28, released 1988-07-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02588 (Start-161)
      • conflict (2-3)
      • conflict (99)
    Domains in SCOPe 2.04: d4tnca_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tncA (A:)
    tsamdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkedakgkseeeladcfrifdknadgfidieelge
    ilratgehvteediedlmkdsdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tncA (A:)
    amdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaii
    eevdedgsgtidfeeflvmmvrqmkedakgkseeeladcfrifdknadgfidieelgeil
    ratgehvteediedlmkdsdknndgridfdeflkmmegvq