PDB entry 4tn6

View 4tn6 on RCSB PDB site
Description: CK1d in complex with inhibitor
Class: Transferase/Transferase Inhibitor
Keywords: ser/thr kinase, inhibitor, transferase-transferase inhibitor complex
Deposited on 2014-06-03, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tn6a_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tn6b_
  • Heterogens: PFO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tn6A (A:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasra
    alvprgspgggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tn6A (A:)
    elrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqg
    gvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihs
    knfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryas
    inthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlc
    kgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tn6B (B:)
    melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
    ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
    sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
    sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
    ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfgasra
    alvprgspgggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tn6B (B:)
    elrvyrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggvg
    iptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknf
    ihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasint
    hlgieqsrrddleslgyvlmyfnlgslpwqgltkrqkyerisekkmstpievlckgypse
    fatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnm