PDB entry 4tn5

View 4tn5 on RCSB PDB site
Description: Crystal Structure of Predicted Fructose Specific IIB from Escherichia Coli
Class: transferase
Keywords: IIB, EIIB(fruc), alpha/beta, phosphoryl group transferase, EIIA, EIIC, TRANSFERASE
Deposited on 2014-06-03, released 2015-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-like phosphotransferase enzyme IIB component 3
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: frwD, yijN, b3953, JW3925
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4tn5a_
  • Chain 'B':
    Compound: Fructose-like phosphotransferase enzyme IIB component 3
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: frwD, yijN, b3953, JW3925
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4tn5b_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tn5A (A:)
    maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
    llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tn5B (B:)
    maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
    llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile