PDB entry 4tn5
View 4tn5 on RCSB PDB site
Description: Crystal Structure of Predicted Fructose Specific IIB from Escherichia Coli
Class: transferase
Keywords: IIB, EIIB(fruc), alpha/beta, phosphoryl group transferase, EIIA, EIIC, TRANSFERASE
Deposited on
2014-06-03, released
2015-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2015-06-10, with a file datestamp of
2015-06-05.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.23
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fructose-like phosphotransferase enzyme IIB component 3
Species: Escherichia coli K12 [TaxId:83333]
Gene: frwD, yijN, b3953, JW3925
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4tn5a_ - Chain 'B':
Compound: Fructose-like phosphotransferase enzyme IIB component 3
Species: Escherichia coli K12 [TaxId:83333]
Gene: frwD, yijN, b3953, JW3925
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4tn5b_ - Heterogens: NI, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4tn5A (A:)
maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4tn5B (B:)
maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile