PDB entry 4tkv

View 4tkv on RCSB PDB site
Description: CO-bound Nitrogenase MoFe-protein from A. vinelandii
Class: oxidoreductase
Keywords: Nitrogenase, FeMo-cofactor, Inhibition, OXIDOREDUCTASE
Deposited on 2014-05-28, released 2014-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.139
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07328
      • conflict (439)
    Domains in SCOPe 2.07: d4tkva_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tkvb_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07328
      • conflict (439)
    Domains in SCOPe 2.07: d4tkvc_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tkvd_
  • Heterogens: HCA, ICE, IMD, CMO, CLF, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tkvA (A:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfrqmhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkvA (A:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfrqmhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tkvB (B:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkvB (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4tkvC (C:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfrqmhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkvC (C:)
    msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
    yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
    vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
    egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
    emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
    ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
    igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
    gikekfifqkmgipfrqmhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4tkvD (D:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tkvD (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr