PDB entry 4tkp

View 4tkp on RCSB PDB site
Description: Complex of Ubc13 with the RING domain of the TRIM5alpha retroviral restriction factor
Class: ligase
Keywords: HIV restriction, TRIM5, Ubc13, E3 Ubiquitin ligase, RING dimerization, LIGASE
Deposited on 2014-05-27, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2N, BLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tkpa_
  • Chain 'B':
    Compound: Tripartite motif-containing protein 5
    Species: Macaca mulatta [TaxId:9544]
    Gene: TRIM5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4tkpA (A:)
gtaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflp
eeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdd
plandvaeqwktneaqaietarawtrlyamnni

    Sequence, based on observed residues (ATOM records): (download) 
    >4tkpA (A:)
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpdndvae
qwktneaqaietarawtrlyamnni

  • Chain 'B':
    No sequence available.