PDB entry 4tgl

View 4tgl on RCSB PDB site
Description: catalysis at the interface: the anatomy of a conformational change in a triglyceride lipase
Deposited on 1991-07-29, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.129
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4tgl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tgl_ (-)
    giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
    mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
    tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
    anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
    snsivpftsvldhlsyfgintglct