PDB entry 4tgl

View 4tgl on RCSB PDB site
Description: catalysis at the interface: the anatomy of a conformational change in a triglyceride lipase
Class: hydrolase(carboxylic esterase)
Keywords: hydrolase(carboxylic esterase)
Deposited on 1991-07-29, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.129
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triacyl-glycerol acylhydrolase
    Species: Rhizomucor miehei [TaxId:4839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19515 (Start-268)
      • conflict (180)
      • conflict (219)
    Domains in SCOPe 2.07: d4tgla_
  • Heterogens: DEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tglA (A:)
    singgiraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliy
    dtnamvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqn
    elvatvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvg
    npafanyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdle
    tsdcsnsivpftsvldhlsyfgintglct
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tglA (A:)
    giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
    mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
    tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
    anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
    snsivpftsvldhlsyfgintglct