PDB entry 4tgf

View 4tgf on RCSB PDB site
Description: solution structures of human transforming growth factor alpha derived from 1*h nmr data
Deposited on 1990-06-13, released 1991-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4tgf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tgf_ (-)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla