PDB entry 4tf4

View 4tf4 on RCSB PDB site
Description: endo/exocellulase:cellopentaose from thermomonospora
Deposited on 1997-05-31, released 1997-09-04
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tf4A (A:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tf4B (B:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap