PDB entry 4skn

View 4skn on RCSB PDB site
Description: a nucleotide-flipping mechanism from the structure of human uracil-dna glycosylase bound to dna
Deposited on 1999-02-20, released 1999-02-26
The last revision prior to the SCOP 1.63 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.189
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.63: d4skne_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4sknE (E:)
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqnpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsprsvyrgffgcrhfsktnellqksgkkpidwkel