PDB entry 4skn

View 4skn on RCSB PDB site
Description: a nucleotide-flipping mechanism from the structure of human uracil-DNA glycosylase bound to DNA
Class: hydrolase/DNA
Keywords: DNA glycosylase, DNA base excision repair, uracil, DNA, hydrolase/DNA complex
Deposited on 1999-02-20, released 1999-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(*tp*gp*gp*gp*(d1p)p*gp*gp*cp*tp*t)-3')
  
• Chain 'B':
  Compound: DNA (5'-d(*ap*ap*ap*gp*cp*cp*gp*cp*cp*c)-3')
  
• Chain 'E':
  Compound: protein (uracil-DNA glycosylase)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13051 (3-222)
    • cloning artifact (0-2)
    • engineered (63)
    • engineered (190)
  Domains in SCOPe 2.07: d4skne1, d4skne2
• Heterogens: URA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4sknE (E:)
  meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
  lgqnpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
  llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
  hvlqtahpsprsvyrgffgcrhfsktnellqksgkkpidwkel