PDB entry 4sga

View 4sga on RCSB PDB site
Description: structures of product and inhibitor complexes of streptomyces griseus protease a at 1.8 angstroms resolution. a model for serine protease catalysis
Deposited on 1990-05-29, released 1991-10-15
The last revision prior to the SCOP 1.63 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.116
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Domains in SCOP 1.63: d4sgae_

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4sgaE (E:)
  iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
  hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
  ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
  l