PDB entry 4s3s

View 4s3s on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I92K/V23A at cryogenic temperature
Class: hydrolase
Keywords: OB-fold, nuclease, nucleic acid, HYDROLASE
Deposited on 2015-06-19, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (43-44)
      • engineered mutation (85)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d4s3sa_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s3sA (A:)
    atstkklhkepatlikaidgdtaklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s3sA (A:)
    lhkepatlikaidgdtaklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws