PDB entry 4s2s

View 4s2s on RCSB PDB site
Description: Crystal Structure of Fab fragment of monoclonal antibody RoAb13
Class: immune system
Keywords: Immunoglobulin, IMMUNE SYSTEM
Deposited on 2015-01-22, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RoAb13 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4S2S (0-223)
  • Chain 'B':
    Compound: RoAb13 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4S2S (0-216)
    Domains in SCOPe 2.07: d4s2sb1, d4s2sb2
  • Chain 'H':
    Compound: RoAb13 Fab Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4S2S (0-223)
  • Chain 'L':
    Compound: RoAb13 Fab Light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4S2S (0-216)
    Domains in SCOPe 2.07: d4s2sl1, d4s2sl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s2sB (B:)
    divmsqspsslavsvgekvtmsckssqsllyrgnqmnylawyqqkpgqspklliywastr
    esgvpdrftgsgsgteftltissvkaedltvyycqqyytyprtfgggtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s2sL (L:)
    divmsqspsslavsvgekvtmsckssqsllyrgnqmnylawyqqkpgqspklliywastr
    esgvpdrftgsgsgteftltissvkaedltvyycqqyytyprtfgggtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnr