PDB entry 4s1w

View 4s1w on RCSB PDB site
Description: Structure of a putative Glutamine--Fructose-6-Phosphate Aminotransferase from Staphylococcus aureus subsp. aureus Mu50
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Structures of Mtb Proteins Conferring Susceptibility to Known Mtb Inhibitors, MTBI, Essential Enzymes, transferase
Deposited on 2015-01-15, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Staphylococcus aureus subsp. aureus [TaxId:46170]
    Gene: glmS, BN965_3160, BN966_160, BN967_17410, BN968_17600, ER16_10920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s1wa_
  • Chain 'B':
    Compound: Glutamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Staphylococcus aureus subsp. aureus [TaxId:46170]
    Gene: glmS, BN965_3160, BN966_160, BN967_17410, BN968_17600, ER16_10920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s1wb_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s1wA (A:)
    aekgvyahymlkeiheqpavmrriiqeyqdaegnlkidqdiindvkeadriyviaagtsy
    haglvgkeflekwagvptevhvasefvynmpllsekplfvyisqsgetadsravlvetnk
    lghksltitnvagstlsreadhtlllhagpeiavastkaytaqiavlsilsqivakehgr
    eadidllrelakvttaieaivddapimeqiatdflettrnaffigrtidynvslegalkl
    keisyiqaegfaggelkhgtialiedgtpvvalatqenvnlsirgnvkevvargahpcii
    smeglekegdtyviphvhelltplvsvvalqlisyyaalhrdldvdkprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1wA (A:)
    vyahymlkeiheqpavmrriiqeyqdaegnlkidqdiindvkeadriyviaagtsyhagl
    vgkeflekwagvptevhvasefvynmpllsekplfvyisqsgetadsravlvetnklghk
    sltitnvagstlsreadhtlllhagpeiavastkaytaqiavlsilsqivakeheadidl
    lrelakvttaieaivddapimeqiatdflettrnaffigrtidynvslegalklkeisyi
    qaegfaggelkhgtialiedgtpvvalatqenvnlsirgnvkevvargahpciismegle
    kegdtyviphvhelltplvsvvalqlisyyaalhrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4s1wB (B:)
    aekgvyahymlkeiheqpavmrriiqeyqdaegnlkidqdiindvkeadriyviaagtsy
    haglvgkeflekwagvptevhvasefvynmpllsekplfvyisqsgetadsravlvetnk
    lghksltitnvagstlsreadhtlllhagpeiavastkaytaqiavlsilsqivakehgr
    eadidllrelakvttaieaivddapimeqiatdflettrnaffigrtidynvslegalkl
    keisyiqaegfaggelkhgtialiedgtpvvalatqenvnlsirgnvkevvargahpcii
    smeglekegdtyviphvhelltplvsvvalqlisyyaalhrdldvdkprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1wB (B:)
    kgvyahymlkeiheqpavmrriiqeyqdaegnlkidqdiindvkeadriyviaagtsyha
    glvgkeflekwagvptevhvasefvynmpllsekplfvyisqsgetadsravlvetnklg
    hksltitnvagstlsreadhtlllhagpeiavastkaytaqiavlsilsqivakeheadi
    dllrelakvttaieaivddapimeqiatdflettrnaffigrtidynvslegalklkeis
    yiqaegfaggelkhgtialiedgtpvvalatqenvnlsirgnvkevvargahpciismeg
    lekegdtyviphvhelltplvsvvalqlisyyaalhrdldvdk