PDB entry 4s1n

View 4s1n on RCSB PDB site
Description: The crystal structure of phosphoribosylglycinamide formyltransferase from Streptococcus pneumoniae TIGR4
Class: transferase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, TRANSFERASE
Deposited on 2015-01-14, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: purN, SP_0048
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s1na_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s1nA (A:)
    snamkkiavfasgngsnfqviaeefpvefvfsdhrdayvlerakqlgvlsyafelkefes
    kadyeaalvelleehqidlvclagymkivgptllsayegrivnihpaylpefpgahgied
    awnagvgqsgvtihwvdsgvdtgqvikqvrvprladdtidrfeariheaeyrlypevvka
    lftd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s1nA (A:)
    mkkiavfasgngsnfqviaeefpvefvfsdhrdayvlerakqlgvlsyafelkefeskad
    yeaalvelleehqidlvclagymkivgptllsayegrivnihpaylpefpgahgiedawn
    agvgqsgvtihwvdsgvdtgqvikqvrvprladdtidrfeariheaeyrlypevvkalft